Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
Home
My WebLink
About
BUILDING SITE PLANS
FILE COPY FEB 11 2019 5T, I,.C10 Cuunty, parmitting O'.H. Finish Columns with '8" thick cut coral ished stucco bands 12 4 1 SLOPE COVERED PORCH Gulf Coast Supply and MFG 5v Crimp Metal roofing FL #11451.12 26 ga. 5v crimp metal roofing attached to plywood deck using #9 x 1.5" wood screws with self sealing washer at 12" o.c. max spacing over ASTM D (type 2) 30 lb felt underlayment installed with min. 4' side laps and L" end laps fastened with corrosion resistant tin caps and with 1.25" ring shank nails spaced L" o.c. at all laps and two staggered rows 12" o.c. in field. Attach deck,to trusses using attachment detail on this sheet —� EGRES Q ' ® 5/8" thick light textured — — — — — — — — — — stucco on typical concrete -A — block construction 5/8" thick x 8"w cut coral finished stucco bands LEFT ELEVATION SCALE: 1/4" = 1'-0" Gulf Coast Supply and MFG Sv Crimp Metal roofing FL #11651.12 2L ga. 5v crimp metal roofing attached to plywood deck using #9 x 1.5" III screws with self sealing washer at 12" o.c. max spacing over ASTM D (tgpe 2) 30 lb felt underlayment installed with min. 4' side laps and 6" and Imps fastened with corrosion resistant tin caps and with 1.25" ring shank nails spaced L o.c. at all laps and two staggered rows 12" o.c. in field. Attach deck to trusses using attachment detail on this sheet 2" H. 5/8" thick x 8"w cut 3 coral finished stucco bands ----------- --+-----+ — ----------------- RIGHT ELEVATION u 1 5/8" thlck light textured stucco on typical concrete block construction SCALE: 1/4" = 1'-0" 01 Product Approval Submittal Affidavit Opening Schedule Swing Doors, Overhead Door@, Sliding Doors, Vindows dt Skylights Opening Type NOA/FL Product Model Manufacturer Glass Attachment method EspIEST Lion Date Design Pressure of Approved Teets I,2,3 FLU 11499.2 Single Hung Series 185 MI Windows and doors L Ip. x cone W mln. pn ra t1en at m ran each tamer and Lac. taeraa/tar thra Pgf T 6uck into ea'd filled CMU wall maintaining min 2.5" edge dstance in strict adherence to the product a koroval. ± 60 psf A I1-1108.30 Overhead Garage Door Model 824/ II ell max widt } iL'-O" max heig t DAB 11 es 6. "v.rt oe q dirt x i wa'W a '..t ad call "'too h i. qqy au�hF 8F rtWgdoie�a. e'" m. ii . a rt to auek 1Ti si F t ra.aan six or i. ea. arm"" - ue to .e. q whe.e to product am,ww% 10-9-21 + 50.0/-LO.O oaf B FLU 14414.1 Fiberglass Design Pro/ Smooth Pro Jeld-Wen Ico 1/4' dia. topcon with own 1.25" embedment at 3" max From corners and ITS' o.c. max. thereafter in hard and ,Iambs. ± 50.0 PSF C FL# 15332.2 Sliding Glass Door Series 420 Mi Windows and doors ran eae� carver n fac. a 121a row 1/1"Lherea t., ihcwg max. PT Buck into slip Bled GMU wail maintaining min .5' ad s dutancs in strict adherence to the J wall approval.ng g + _ 48.2 PSF Product NI NUMBER Model # Manufacturer Attachment Method Ezp�tion END Design Pressure of Approved Teats Mullions FLU 15353.8 CM-18531 vertical mullion Mi WIr7Bows and doors For CMU use (2) 1/4" x 2 3/4" tapcone with min 1 1/4" embedment penetration into each Mull Clip. Attach mull to clip using (4) #10 x 1.25" sell tapping screws per clip as shown in product approval. + 118.9 PSF Roof FL# 11651.12 5V Crimp Metal RooFin g Gulf Coast Supply and manufacturing 26ga. 5v crimp metal roofing attached to plgwood deck using #9 x 1.5" wood screws with self sealing washer at 12" o.c. max seating over ASTM D (Lgpe 2) 30 lb Pelt underlegmant installed with min. 4 side laps and 0 and laps fastened with corrosion resistant tin caps and with 1.25" ring shank nails spaced L c.c. at all laps and two staggered rows 12" c.c. in IAttach Back to trusses using attachment detail an roof plan - 108.5 PSF Siding Stucco on Block Soffit FLU 12198.3 Model T4 12" vented yin I Soffit Kaycan Install using 2" x 2" battens at V o.c. screwed to soffit framing using #e x 3 wood screws at each truss.nals Install soffit to battens using +55.0/-35.0 PSF Hurricane Panels FI# 15014.2 24 Gauge Storm Panels Global Protection Products LLC Install using I/2" din. solid set lead anchors with 114' dia.-20 x 1.5" long SS screw head combo. with Neoprene washer at 12 1/2" o.c. along the bottom and 13" o.c. at the top ± 45.0 PSF I have reviewed the above and approved it by my seal below. ( Architect or Engineer of Record 12 SLOPE 4 all Gulf Coast Supply and MFG 5v Crimp Metal roofing PI_ #11451.12 24 ga. 5v crimp metal roofing attached to plywood deck using 99 x 1.5" wood screws with self sealing washer at 12" o.c. max spacing over ASTM D (type 2) 30 lb, felt underlayment installed with min. 4' rode laps and L" end laps fastened with corrosion resistant tin caps and with 1.25" ring shank nails spaced L" o.c. at all laps and two staggered rows 12" o.c. in field. Attach deck to trusses using attachment detail on this sheet 12 SLOPE 4 2„ .I COVERED PORCH C 5/8" thick light textured 5/8" thick x 8"w cut 9tUCC0 on typical concrete coral finished stucco bands block construction REAR ELEVATiON SCALE: 1/4" - 1'-0" Gulf Coast Supply and MFG 5v Crimp Metal roofing FL #11451.12 26 ga. 5v crimp metal roofing attached to plywood deck using #9 x 1.5" wood screws with self sealing washer at 12" o.c. max spacing over ASTM D (type 2) 30 ib felt underlayment installed with min. 4' side laps and V end laps fastened with corrosion resistant tin caps and with 1.25" ring shank nails spaced L o.c. at all laps and two staggered rows 12" o.c. in field. Attach deck to trusses using attachment detail on this sheet II EGRESS O ' 5/8" thick x 8"w cut coral finished stucco bands FRONT RONT 2" x 4" top plate 1/2" drywall ceiling on truss bottom cord 1/2" drywall on 2" x 4" studs at 14" O.C. base -board 11 11 / 2" x 4" P.T. bottom plate \ 4" concrete slab with fibermesh OR Vx6" 910/10 WWM on 6 and Visqueen over clean compacted termite treated fill Interior Non —Bearing Partition nts LEV ATiON ST. LUCIE COUNTY BUI 6 I I ION REVIEWED FOR COMPL N E REVIEWED BY 5� GC�4 "'r(j DATE iz PLANS AND PERMIT MuWl BE KEPT ON JQB SITE OR NO INSPECTION(S) WILL BE MADE ALL MANUFACTURES CABLES SHOWING U FACTORS AND SHGC COMPLIANCE WITH FBC ENERGY CODE MUST REMAIN ON ALL DOORS AND WINDOWS UNTIL INSPECTIONS ARE APPROVED Z THESE PLANS AND ALL PROPOSED WORK ARE SUBJECT TO ANY CORRECTIONS REQUIRED NY FIELD INSPECTORS THAT MAY BE NECESSARY 1N OP0 FR TO" COMPLY WITH ALL APPLICABLE CODES. CONCEALED FASTENERS OR ATTACHMENTS ARE THE RESPONSi61LITY OF THE CONTRACTOR OF RECORD 1/8" Thick cut coral stucco over paper backed wire lath nailed to substrate through one layer of 15 lb felt using 8d nails. Substrate to be 19/32" COX Plgwood nailed at 6" o.c. in field and edges with 10d ring shank galvanized nails into truss webbing. 12 � SLOPE 14 SCALE: 1/4" = 1'-0" 5 ALL CONTRACTOR WARRANTIES BEGiN WHEN THE CLOSING OCCURS BETWEEN THE BUYER AND WYNNE BUILDING CORP. AND WILL CONTINUE FOR ONE YEAR FROM THAT DATE PERMITTING INFORMATION (FORM 100) Florida Building Code Residential: Lth Edition and ASCE 1-10 for Wind Loading Building Design is: Enclosed Risk Categor Mean Roof Height: II'-0" Roof Pitch: : It Wind Velocitg: III mph ultimate Internal Pressure C lcient: ±0•18 SubJectability to damage from: Weathering: Negligible Termites: Veru Heavu Width of Roof End Zone: 3'- " Wind Speed: III mph ultimate Wind Exposure Classification: C 1,21 x O.L Adjustment factor for Exposure Height: = 0.12L ASD design ct Load Combination: ASCE 1-10 Seion 2.4 DL+LL: DL+O.LWL. O.LDL+O.LIUL Components E Cladding Wind Pressure (NET) Roof Zone: I. +20.1/-32.L peF Roof Zone: 2. +20.L/-51.0 pet Roof Zone: 3. +2O.L/-84.0 psf TO 1ESPITCH SCANNED BY St. Lucie County Components E Cladding Wall End Zone Width: 3'-4" Components E Cladding Wind Pressure (NET) Wall Zone: 4.+35.8/-38"1 par 0 one i Walls Roof Z4 Wall Zone: S. psfZone +35.8/-41.8 Components E Cladding Wind Pressure (NET) on Garage Door:+32.0/-40.3psf Shear Walla Considered for Structure? yes Provided? Roof Zone 2 ®Walls Continuous Load Path Yes Zone 5 Are Components an Cladding Dartaairs Provided? Yea END ZONE Minimum Soil Bearing Pressure.2,500 psi, Presumptive: X Bg Test: psi This Building Shall Have the Following: X = Corner Zones Zone 3 APPROVED SHUTTERS: IMPACT GLASS: BOTH: NEITHER: Roof ROOF LIVE LOAD: 31 psf ROOF DEAD LOAD: 10 psf FLOOR LIVE LOAD:,_ pat FLOOR DEAD LOAD: 10 Pat JOB A0DRE3S: \l-"0iii�A QnCli,_� FLOOR PLAN AREA CALCULATIONS CRASH POST DETAIL AREA A/C = 1120 s ft. TYPICAL NOTES: SCALE I/4" = I'-O° 9 q• N.T.s = 1. Contractor t0 verify ALL notes and dimensions prior t0 36" high by Back Porch Total 210 s" ft. 4" diameter q steel crash post. Floor Gare e = 31-1 S . ft. proceeding with work. Flange with 4 - 3/8" Entrg 2$ s ft. 2. Contractor to STRICTLY enforce ALL OSHA Requirements. ex ansion bolts Into g = q. 3. ALL Lumber to be used as Beam, Rafters, etc... to have slag (3/8"t 50 ksl steel plate) f a minimum 1,9�00 P.S.I. fiber stress. `" - 2215 sq. ft. Total Cubic Ft Total Under Roof '4. No dissimilar metals to touch. 2�" 2%" 13,%0 5. ALL Concrete used for slabs shall be min. 2,500 PSI concrete. ALL Concrete used for vertical filled cells, cont. tie beams etc.. to ° 2" VTR shall be 3,000 P.S.I. concrete and/or 4,000 P.S.I. grout mix2 . 6. Drywall at ceilings shall be leveled and attached to bottom chord JiL of trusses with screWS per FBC R102.3.5. Attach buck to block wall with I p 2/` 114" dia. Elco cone screws with min. I 1. ALL wood in contact with concrete shall be pressure treated. ° ° I I/4" penetration at 12' o.c. max I 8. ALL wall dimensions are nominal and not finished wall or stud dimensions. �" Exterior face 2 x L Vand 4max from each corner thru PT Buck 2 F VTR 9. ALL plumbing fixtures to be low flow. or wall °r1Q8 //'1 JiL 10. Contractor to Provide Drain at water heater in accordance An ( I 1 with the current edition of the Florida PlumbingCode. 1 2. I #8 wood screws thru jamb Intgitar I t0Y I II. Contractor to Provide a 2'-8" wide door at one bathroom for at each hinge and 15" o.c. max iii 2 handicap accessibility requirements Detail at Door poor to door attachment �ay. I 12. Lowest finished floor to be set by Governing Building Department L" NTS '" 12` VTR w.�. JIL 13. surve or to set in field. y Separation between residence and garage shall be per FBC R302.6 INSTALL ON ALL VULKEM BLOCK SEALANT a' I JAMB, HEADER, AND 2• I 1'4. Door between garage and residence Shall be 1-3/'4"t 20 min. rated door INST4LLATIONRIOR TO BUCK shur, tit. sink 1 Water Heater Install windows thru buck into 2' block with 3/10 tap -con with Kitchen 15. Wall and Ceiling shall have a flame -spread classification of not greater than 200 per FBC R302.9.1 I I/2" penetration at L' o.c. max. theeafter atnambadand 20' o.c max Lev. l 16. Wall and ceiling finishes shall have a smoke -developed index of not greater than '450 per FBC R302.9.2 Exterior Pace at head and sill per product approval 11. All exposed attic insulation materials installed on attic floors shall have a critical radiant of wall Buck to be I' x 4' PT flux not less than 0.12 watt per square centimeter. Exposed foam plastic insulation 3 Varies W.C. materials exposed on the underside of the roof deck or on the attic walls shall comply with F.B.C. R316 - see permit info box of code edition Bath #2 Sher. 18, Gg�rppsum board material shall conform to ASTM C36, C19, C4 15, C514, C630, C931 s I"x4' P.T. Buck nailed to C°I60, C1002, CIO.41,CiI-1-i, CII-18, C1218, C1395, or C1396 and shall be installed Detail lack with case hardened nails C.O. at Windows prior to window attachment To septic accordingt0 the following: (FBC R�02.3.5) g= Masonry Beam I" x L" P.T. Buck nailed to / Drywall Framing Max spacing block with case hardened nails NTS P L U M B I N G� RISER prior to door attachmen> NTS Thickness Location Orientation Member �' Fasteners Nod sizing options for Spacing installation of drywall into Ma)amum Nails FScrows wood framing members 2" x min, thickness Ceiling Perpendicular 24" 1" t2" 13ga 1 3/8" long with 19/64" head 0.098" diameter x 1 1/4" long /2 annular -ringed or 5d cooler nail OR 0.080" dia. x 1 5/8" long with Walla Either IL" 81, 161. Direction 15/64" head R Gypsum board nail 0.084' dia. x 15/8" with 9/32" head. Ceiling Perpendicular 24" 1„ 12„ 13ga 1 5/8" bong with 19/44" head OR 0.098" diameter x 1 3/8' long II annular -ringed or Ld cooler nail OR Walls Either 16" 8a IL" 0.092" dia. xx 1 1/8' long with Direction I/4" heed OR Gypaum board nail 0.0915' dia. x 11/8' with 19/64" head. Install SGD thru buck into block with 3/16" tap -con with 1 1/2" penetration at 6" o.c. max. from each corner and 20." o.c. max thereafter at head per product approval 0 Use 3/14" tap -con with 1 1/2" penetration at 6" o.c. max. from each corner and 20" o.c. max thereafter at sill per product approval I" x L" P.T. Buck nailed to block with case hardened nails Head prior to door attachment fixed door sliding door 19. ALL ceramic tile surfaces installed shall conform to ASTM A108.1 thru A108.6, " Masonry WallL- A108.1, A118.1, A118.3, A136.1 and A131.1 20. Cement, fiber -cement or glass mat g psum backers in accordance with ASTM y ".r.•i..,r'Af l':°�w %�•'...;Y,.'..�:..'n-YAf�i li. _'. i.!ui^("�.]C'•. ::..I s+.v �.'��,.. C1288, C1325, OR C11�8 and installed I.A.W. manufacturers recommendations shall Bottom Track Typical Flooring be used as backer for the wall the in tub areas and wall panels in shower areas. Sill Install SGD thru buck into 21. Insulation includingfacings such as retarders or vapor permeable block with 3/14" tap -con with acia g por p ermeae members installed 1 1/2" penetration at L" o.c. max. within floor -ceiling assemblies, roof -ceiling assemblies, wall, crawl spaces and attics Sliding D OOr D G t a I I from each corner and 20 o.c. max shall have a flame spread index not to exceed 25 with an accompan ingg smoke thereafter at Jambs per product approval Jamb developed index not to exceed 450 when tested in accordance witli ASTM E 84. At Masonry Wall NTS insulation shall comply with F.B.C. R316. Gulf Coast Supply and MFG 5v Crimp Metal roofing FL #11451.12 26 ga. Sv crimp metal roofing attached to plywood deck using #9 x I.S" wood screws with self sealing washer at 12" o.c. max spacing over ASTM D (type 2) 30 lb felt underlayment installed with min. 4' side laps and L" end laps fastened with corrosion resistant tin caps and with 1.25" ring shank nails spaced 6" o.c. at all laps and two staggered rows 12" o.c. in field. Attach deck to trusses using attachment detail on this sheet Simpson HETA 20 or equal hurricane anchor at each truss with (10) 10d x 1 1/2" nails ( 24" o.c.) suppporting Max. 18101hs. upld't Aluminum Dnp Edge t Fascia 7 2" x 6" Sub -Fascia Kaycan Pull o vent vinyl soffit installed using1/8' die shank x 15" long goly. roo♦ing nails with 3/8' dia. head per product approval - see chart sheet #1 5/8" thick light textured stucco on typical concrete \ block construction #5 bar vert. w/ 30' overlap at each Pilled cell Grade 12 41 Wood Base TYPICAL SECTION 'PRE-ENGINEERED TRUSSES at 24"o.c. TYPICAL (shop drawings by manufacturer) \R-30 blown fiberglass in bottom chord of trusses -1/2' drgwall with smooth finish Two rows of beam block Pilled with concrete _and (1) #5 bar cost. in each row. Substitute precast lintel filled with concrete and (U #5 bar cont. for bottom row over openings 1/2" drywall over I" x furring strips at 14" o.c. with R4.1 fr-foil -insulation on typical 8" Block walls All drywall to be installed per FBC R102.3.1 and shall meet all pertaining ASTM codes. Mortar to be Type "M" only proportioned per FBC R601.1 and Mortar Jonts shall comply with FBC R6O1.2.1. Provide Our-O-Rock at all wet areas (ex. showers, tubs etc...) Fill cell with concrete and (1) #5 bar vert. (typical). -Max. spacing shall not exceed 48" unless otherwise noted see foundation plan notes for Spacing at openings 4" concrete slab with fibermesh OR L"xb" #10/10 WWM on 6 mil Visqueen over / clean compacted termite treated fill IIII �IIII�j1,1111- �j1,111 14" x 14" Concrete footing with (2) #5 bars cont. and #5 transverse bars at 48" o.c. Scale : 1/2" = 1'-0" Window Schedule Mark Size Rough O en. Window Descrl tion PRESSURE ZONE I. 4'-5%a"x 5'-3%e' 54ke"x L3%" Single Hung ZONE 4 2. V-2%a"x 5'-3 %" 15" x 63 %' Single Hung ZONE 4 3. 2'-2" x 3'-2V 21%2'x 38%' Single Hung ZONE 4 4. 3'-1" x 5'-3%a" 38" x L3'/4" Single Hung ZONE 4 S. 4'-5;1a"x 4'-2%" 54%"x 54Ya" Single Hung ZONE 4 ALL Windows to be aluminum Windows w/ tint and mullions per elevations. ALL windows to withstand pressures in permit info box on sheet I ALL windows in bathrooms to be tempered All rough opening dimensions to be verified by contractor with manufacturer s specs prior to construction r, Door Schedule Mark Size Rough Opening Door [Description PRESSURE ZONE A 9'-0" X 1'-0" 108' x 84" Overhead Garage Door ZONE 4 B 3'-0' X V-S" 41"%" x 83s/," Fiberglass Panel - Inswing ZONE 4 C L'-O" X V-8" 14" x 81 %2" °alai Sliding Glass Door ZONE 4 D X-0" X L'-8' Solid Core - Wood - 6-Panel-BrFold Finished 24' x 81 %2" E 2'-0 X V-8" Solid Core - Wood - L-Panel F 5'-0" X 6'-8" Solid Core - Wood - 6-Panel - Br-Fdd G 2'-a' x V-8" x 1'/1" Solid Core Wood, Steel, or Masonite Door H 2'-8" X 4'-8' Solid Core - Wood - L-Panel J 2'-6" X C-8" Solid Core - Wood - 6-Panel - Bi-Fold ALL Exterior doors to withstand pressures stated in permit info box on sheet 41 GARAGE DOOR SPECIFIED IN PRODUCT APPROVAL FORM AND SHALL WITHSTAND THE PRESSURES STATED IN PERMIT INFO BOX ON SHEET 41 All rough opening dimensions to be verified by contractor with manufacturers specs prior to construction Braden It Braden AIA, PA Architects - Planners 411 S.E. Coconut Avenue 01B Tel : (112) 281-82b8 Fax : (112) 281-8283 E-mail; bradenaia8comcast.net Stuart_ FL 34996 #AACOOOOS2 21'-0" 14'-O" 10'-0 OI: tOIf'1NTL(@6@6AB 3'-lorx„ 2 ON THIS PERMIT ° 0 EGRESS 12" x 12" Concrete column block filled with concrete and (2) #1 bare Vert. tied Into Olintels above PORCH WIRE LATH i STUCCO CEILING ° O T 1 4„ O I 8'-0" to 9' 18" A.F.F. OL Vaulted Ceiling O I n i MASTER BEDROOM2(14 8'-0" A.F.F. OL Flat Ceiling 12'-8" Vanity to be 34 Y2"high i lRod t Shelf GREAT 1 I ROOM -4" N _ J ° 1 a- 2" x 6" knee -wall 1 I below counter top I LOSE �II „ 1 s„ ocL --- ° ad t Shelf ® DINING I ROOM I- -O" to T-8" A.F.F. 141" HIGH WALL ° Vaulted Ceiling 1 I 8'-0" A.F.F. ■ ' e � I1, , ' O 0 c • • J K) :.',�i r J)`u!„ 12'-6" SECOND BEDROOM V-O" A.F.F. Flat Ceiling EGRESS 1-1/2" OVE HANG Flat Ceiling - - - - - - - K-ItCHEN ° O Up ar cabinets to - iv extend over Ref 10, 4, NON -VENT O - st71R'G t'+ in w.H 22' x 54" 1 J v Attic Access I R-11 Batts in aacn IU xt/ with light I p / I - J rd Provide auto I we detail an this eel Bsheet closer L__J m ISO[Amp r1 22" I I GARAGE xin O a'-4" A.F.F. J LJ Flat Ceiling N .-a / r----------------- I jBlock wall in D O MT ° (] I garage to be 1 MERE CY 0 I struck block EGR 5 I I I I I I I I I C.C.U. 12-9-09 2'-2" 9'-6" 2'-2" 1 2'-8" 2'-8" 3'-6" 9'-0" 3'-4" 13'-10" 5'-4" 15'-10" 35'-O" _ Dunne Building Corp. THE ROYALE Spanish Lakes St. Lucie County Florida MODEL: Date Drawn Revisions 3-28-18 GARAGE Drawn by: RIGHT c.c.u. Checked by: D.R.B. 0 i N 0 a) ly A/C c 0 Nu- O it Sheet 2. OF 5 Comm # 12-101 STRUCTURAL NOTES: I. ALL FOOTING ARE DESIGNED FOR A MINIMUM OF 2,500 PSF SOIL 8. SLOPE ALL PORCH SLABS, COVERED WALK, ETC. AWAY BEARING CAPACITY. IF ANY SUB -SOIL, MUCK OR NON -UNIFORM FROM HOUSE TO DRAINS (IF PROVIDED) PER PLANS CONDITIONS EXIST, REPORT TO ARCHITECT AND OBTAIN PROPER ENGINEERING DATA FOR DESIGN. 2• ALL SLABS AND FOOTINGS TO BE A MINIMUM 2,500 PSI AT 28 DAYS 9. DESIGN LOADS ARE AS FOLLOWS: ALL COLUMNS, FILLED CELLS, AND BEAMS SHALL BE MIN. 3000 PSI ROOF (DL+LL) = 41 PSF WIND VELOCITY = PER PERMIT INFO BOX ON SHEET #1 BE 3000 P51 OR 4,000 PSI GROUT MIX AT 28 DAYS EXPOSURE ="C" 3. POISON SOIL AND COVER W/ 6 MiL. VISQUEEN WITHIN 24 HOURS. NO SOIL POISONING TO BE ACCOMPLISHED OUTSIDE OF FOUNDATION. 10• ALL REINFORCING STEEL SHALL BE GRADE 60, MEETING ASTM A-16, t 4 GROUND FLOOR SLAB TO BE A MINIMUM 4" THICK W/ 6X6 10/10 A-35 SPECIFICATIONS. ALL ANCHOR TO BE A - 301 STEEL. WELDED WIRE MESH REINFORCING ON 4 MIL. POLYETHYLENE VAPOR BARRIER ON TERMITE TREATED, CLEAN MACHINE COMPACTED FILL 11 ALL DOWELS, SLEEVES, CONDUITS, INSERTS, BLOCKOUT5, ANCHOR (MINIMUM DENSITY). LAP POLYETHYLENE 12" MINIMUM. FIBERMESH BOLTS AND FRAMES SHALL BE IN PLACE PRIOR TO POURING CONCRETE. BE MIX MAY BE SUBSTITUTED FOR WELDED WIRE MESH. FOR OPENINGS AND SPECIAL FEATURES OMITTED ON THESE PLANS, SEE ARCHITECTURAL OR MECHANICAL PLANS WHERE APPLICABLE. 5 LOT TO BE CLEARED OF ALL SMALL PLANT GROWTH AND DEBRIS BEFORE FILL IS BROUGHT IN. FILL MATERIAL SHALL CONSIST OF 1 2• CLEAN GRANULAR SAND CONTAINING LESS THAN 10% MATERIAL MINIMUM CONCRETE PROTECTION FOR REINFORCING BARS: PASSING THE US STANDARD NO. 200 MESH SIEVE. PLACE FOOTING: 3" STRUCTURAL FILL IN LOOSE LAYERS OF 12" IN THICKNESS AND BEAMS: 1-1/2" COMPACT EACH LIFT TO AT LEAST 95% OF ITS MODIFIED DRY PROCTOR VALUE. 13. LAP ALL REINFORCING STEEL A MINIMUM OF 48 BAR DIAMETERS. 6• GENERAL CONTRACTOR TO VERIFY ALL EXISTING CONDITIONS AND 14. USE STRUCTURAL GRADE WOOD WITH A MINIMUM Fb OF 1600 PSI DIMENSIONS. BRING ANY DISCREPANCIES OR OMISSIONS TO THE ATTENTION OF THE ARCHITECT. 15. ALL STANDARD LUMBER SHALL BE SYP WITH A MINIMUM Fb OF 1000 PSI OF NO.2 SOUTHERN PINE, UNLESS NOTED OTHERWISE. 1GARAGE FLOORS TO BE SMOOTH TROWEL FINISH (SLOPPED PER FOUNDATION PLAN). PROVIDE 1-1/2" RECESS FOR OVERHEAD DOOR 16. ALL LUMBER IN CONTACT WITH ANY CONCRETE OR MASONRY SHALL BE PRESSURE TREATED. FASTENERS TO HAVE MIN. G185 RATING. FOUNDATiON FLAN I. Ang changes to plans must be submitted to the architect for approval before proceeding With construction. 2. Contractor shall be responsible for verification of all notation and dimensions before starting construction. 3. Soil conditions assumed to be 2800 psf. Should ang other conditions be encountered, the architect shall be notified in writing for revision -4. V erif g all recess thickness at showers, tile, etc.... S. Contractor to provide filled cell with concrete and 1 1$8 bar vert. at 48" o.c. max. Provide (1) filled cell on each side of openings up to 8'-11" wide. Provide (2) filled cells on each side of openings from L1-0" to 9'-11" and Provide (3) filled cells on each side of openings from 10'-0" and up Contractor to see plans for any other condition used. Foundation walls shall have filled cells at 24o.c• unless otherwise noted (see section) 6. Contractor to provide for Form Board Surveg - Form Board Surveg to be provided to Truss Compang prior to truss construction 1. Contractor to provide for soil test prior to construction and provide a copg of soil test to architect for review prior to construction 8. ALL Reinforcing steel shall be grade LO, meeting ASTM A-16 and A-35 specifications. ALL Anchors to be A-301 steel. 9. Provide a minimum of 3" concrete protection at footings and 1-1/2" concrete protection at beams for ALL reinforcing bars. SCALE: 1/4" = I'-O" FOOTING SCHEDULE Mark size Description I 14"W x 14"D MONOLITHIC FOOTING WiTH 2 #5 BARS CONTINUOUS 12"W X 12"D MONOLITHIC FOOTING WITH (2) #5 BARS CONTINUOUS F 30" x 30" x I6"D COLUMN FOOTING WITH (4) #5 BARS EACH WAY 8"W x 8"D ITHICKEN SLAB EDGE WITH 1 #5 BAR CONTINUOUS ©14"W x 14"D With Curb at Garage MONOLITHIC FOOTING WiTH 2 #5 BARS CONTINUOUS - CURB 9 O'-O" #5 bar vert. w/ Thicken edge to 8"4" 30" overlap SEE TYPICAL with concrete and 4" concrete slab with fibermesh OR at each Filled cell ECTIONS one #5 bar continuous VxV #10/10 WWM on 10 mil Visqueen over clean compacted termite treated fill 4" concrete slab with fibermesh OR GRADE 6"x6" #10/10 WWM on to and Visqueen over clean compacted termite treated fill m i<) Grade _ rril =� PORCH SLAB EDGE DETAIL i I I JEEl ( III— 14% x 14"d concrete monolithic rooting with (2) #5 bars cant. SCALE 1/2" = I'-O" 14" TYPICAL FOOTING DETAIL u5 bar vert. w/ 30" overlap SCALE 1/2" = I'-O" et each felled cell SEE TYPICAL ECTIONS 4" concrete slab with fibermesh OR Adjust curb height 6"x6" #10/10 WWM on 10 mil Visqueen over based on gar. floor 4" concrete slab with fibermesh OR clean compacted termite treated fill slope. Vxt" #10/10 WWM on 10 and Visqueen over #5 bar cant_ #5 bar In curb clean compacted termite treated fill Step per O'-O" a F.F. foundation plan Grade � mE_ 11 —III 10" (2) #5 bars cont. bottom steel — 14"w x 14"d concrete monolithic —IIII I I— Footing with (2) #5 bars Cont. 12" 14" 2 DETAIL AT GARAGE STEPDOWN SCALE I/2" = 1'-0" GARAGE CURB DETAIL 12" x 12" concrete column SCALE 1/2" = 1'-0" block filled with concrete and (2) #1 bars vert. tied into Imtels above Verify house slab ;::•.':`..s:..:';:; height in field Top of footer f 16" below Finished floor I •.'y'. H _ �k�0 P I I l l IIII u „ I — ured 2" x 6" PT wood secith w c mn f of ng withrete (4) 3/8"ilia. x 6" anchor bolt at 18" oov #5 bars each wag y erhead door track secured to wood —"" jamb per manufacturer's product approval 30" Garage Door Jamb Detail COLUMN FOOTING DETAIL GARAGE DOOR To WITHSTAND PRESSURES STATED NTS IN PERMIT INFO BOX ON SHEET #1. SEE PRODUCT SCALE 1/2" = 1'-O" APPROVAL FORM FOR MANUFACTURER MAKE AND MODEL. Termite Protection for New Construction. Soil treatment used for subterranean termite prevention inside the foundation perimeter shall be done after all excavation, backfilling and compaction is complete. If soil area is disturbed after nitial chemical soil treatment area shall be re -treated with a chemical soil treatment including spaces boxed or framed. Treatment must be in accordance with the rules and laws established by the Florida Department of Agriculture and consumer services. Protective sleeves around metallic piping penetrating concrete slab on grade floors shall not be of cellulose containing materials and shall receive application of termicide in annular space between sleeve and pipe. Filled Cell Masonry Column With One #5 From Footing To Tie Beam Conc. Fill To Be 3000 PSi See Floor Plan For Location Single Filled Cell Column NTS Filled Cell Masonry Column With One 45 From Footing To Beam Each. Conc. Fill To Be 3000 PSI See Floor Plan For Location Double Filled Cell Column NTS Braden it Braden AIA, PA Architects — Planners 411 S.E. Coconut Avenue KB Tel (112) 281-8258 Fax (112) 281-8283 E-mail: bradenaiascomcast.net 0 I 0 Z- — —— 4 --- 21'-O" I I 14'-0" 44 )LYI ' 12" x 12" Concrete column �t. PATIO/SLA block filled with concrete and (2) #1 bars vent. tied Into � m lintels above — a I T ° I — FI — — —— Filled cell under girder above I FI W Rear Porch Slab to I� (L be poured separatelg from House Slab. , I U) n " I — I Thicken footing to m I r 24% x 14"d x 24"L 4L (] I under filled cell I q ;D ° QQ Iw ° under girder bearing. em"— --- — — —— _ \ N_ _U u- f FI Rear Patio/Slab to beflush with sliding door brottom of recess - Slope O Slope I" i 'I I _4 I FI I o �I I I C)l I 4" concrete slab with fibermesh OR I H.B. I I 6"x6" #10/10 WWM on 6 mil Visqueen over clean compacted termite treated fill O I FI I I I I I I o I f_ i "---T i- i I o ry °❑ I it I lI I I F1 I I FI I I I II o ° j O o — — -- - a 1 1 0= 1 I I �--4"@ Steel Ballard I — I Q I Sae detail on this sheet , I I I — I I I I I I I I I FI I I --- I IEJ 70-11 4" concrete slab with fibermesh OR I 16"xL" #10/10 WWM on 6 and Visqueen over I clean compacted termite treated till I I I UJ I I I I I iv lI ° I L?J° \ �., \ O U U .uN I 'r I I , o I Recess for I ( i— Garage Door— 12'-6" — — — o OO o M o r I °❑IJ LOo O /Ir I I I I I I o ❑° ° r r +�-Af 2'-2" 9'-6" 2'-2" 2'-8" 2'-81, 3'-6" 9'-0" 3'-4" 13'-10" Wunne Building Corp. MODEL: Date 8ralw8n : Revisions THE RO ALE GARAGE TE Drawn by: Ir c.c.u_ Spanish Lakes Checked bg: St. Lucie County Florida D.R.B. Sheet a. OF 5 Comm # 12-101 ROOF SHEETING ATTACHMENT DETAIL I. Minimum Nail Size = Sid ring shank (min. 2.5" long) 2. Minimum Screw Size = 48 x 2" 3. Minimum Sheathing Thickness 19/32" CDX Plywood 4. Use nails or screws bas d on pressure for roof stated in permit info box on t�ese plans for zone 3 Ke Area Ede Field Fastener Max. Pressure Zone 1 611 411 8d ring shank 45 psf Zone 2 4 6" 8d ring shank lb psf Zone 3 4" •4" 8d ring shank 84 psf ** Zone 3a 4" 4" #8 wood screw 112.5 psf ** Use nails or screws based on pressure for roof stated in permit info box on these plans for zone 3 Concrete / Lintel Column Verify with Plan 7 Rebar to Lintel Provide #5 bars with min. 48 bar diameters overlap into beam. Tie Filled cell steel into continuous beam block eteel. Provide Cast -Crete BUB-OB/OT precast lintel set in mortar Min. e" Bearing 12"x 12" lumn Block Provide 05 bar set in pro -cast ROOF f= ^ ;4 N Scale : 1/2" = I'-C" lintel into beam where length of the opening calls for it. — Overhangs at 1'-0" unless Otherwise noted on this sheet / — Roof pitch at 4:12 unless otherwise noted on this sheet IF ,.. Provide PT Buck attached per ,iamb etails into filled cal '• SIII i; 1. �? 1:•:: •'.-1 — Truss shop drawings to be provided by manufacturer — An changes to this plan shall be submitted to the architect for approval in writing prior to starting construction. — ALL TRUSS TO TRUSS CONNECTIONS BY TRUSS MANUFACTURER — Architect to review Truss Shop Drawings Prior Poured Filled Call to construction for layout and uplift verification Contractor to provide for Form Board Survey and to provide Form Board Survey to Truss Company prior to truss construcoc tY Provide U5 bars with min. 48 bar F Filled ell overlap o filled cell. Tie z41. filled call steel Into continuous Footer steel. C crate Anchors Per Ma ufacturA Specs Pourad Concrate ar concrete Mock mall 'I/4"Mar. 'w•r• 9' r. Concrete Footing ;' :. 1 , r ....: > :: ` '.4:. Lam•': (see Footer schedule for exact sizes) DETAIL AT WINDOW OPENING IN CBS WALL Scale: 1/2" = 1'-0" `r tv SINGLE PLY REAR GIRDER TRUSS Nal 2" x 4" blocking to Vert. leg of truss with IOd x 1.5 nails at 4" o.c. II Simpson MGT into wall wringg din. threaded rod set min. 12" wet beam and (22) IOd nails into truss 46 Bar Dls, Rebar TRUSS BLOCKING DETAIL , Min. overlap AT GIRDER STRAPPING AT CENTER BEARING POINT Attachm&nt NTS 1/8' thick light textured stucco installed per ASTM C 924 over ASTM D type 2 paper backed wire lath nailed to substrate through one layer of ASTM D Tlipe 2 felt paper using 8d nails. Substrat to be 19/32" CDX Plywood nailed at G" o.c. in fief and edges with IOd ring shank nails into studs. Gulf Coast Supply and MPG 5V Crimp Metal roofing FL #11451.12 d 26 ga. 5v crimp metal roofing attached to plywood deck using 49 x 1.5" wooscrews with self sealing washer at 12" o.c. max spacing over ASTM D (type 2) 30 lb felt underlayment installed with min. 4' side laps and G" and laps fastened with corrosion resistant tin caps and with 1.25" ring shank nails spaced La o.c. at all laps and two staggered rows 12" o.c. in field. Attach lack to trusses using attachment detail on this sheet �1 Additional Precast Lintel " „ „ u #5 bars Lintel Bar Clear A B CLEAR Length Length Span ESars Bars 2'-10" 2'-8" I'-G" 2 st3 none �----e t----� t ---- All 3'-4" 3'-41, 2'-2" 2,43 none 8F8-OB/IT 8F8-IB/IT 8PB-IB/27 Additional 4'-O" 3'-101, 2'-81, 2,43 none #5 bare ;, ,•, CLEAR.•.�. .::% ;;<;!. 4'-G" 4'-4" 3'-2" 2,#3 none ne Row of "H' r ...: Block Above *! !': ,".,•,:� 5'-4" 5'-2" 4'-0" 2,#3 none i:r• ,r S'-lo" 5'-8" 4'-4" 2 #4 none -t'i?!' Precast Lintelr•oi i ::y:: r••c<• ( G'-G" 4'-41, 5'-4" 2.#4 none a Additional #5 bars 1'-0" 4'-2" 2,45 none 81"IL-IBAT BPI&-IB/2T 8'-4" 1'-10" T-O" 2AG none NOTES: I. min. coverage of steel=l.5" 2. min. bearing required a ea. end=8" ALL reinforcing steel is grade LO. 3. standard for reinf. steel—ASTM A1.I5 TYPICAL LINTEL SECTION ( PRECAST CONCRETE ) LINTEL SCHEDULE Mark Window or D Unit Width Lintel Size Cast -Crete Specification Rows of "H" Block AbOVe " " Bottom steel Size Top Steel size Max Gravity Load (PLP) Max. Uplift Load (Fill Max Lateral Load (PLF) L22 2'-2' V-L" eP8-OBAT 1 #5 30L9 150 1024 L31 1 80 3'-I• 4'-O• 8F8-OBAT 1 #5 2561 13L3 163 L45 4'-5' 5'-10' 8P8-OSAT 1 #5 1105 909 339 L60 5'-O' W-ilia 8F8-OBAT 1 #5 1238 836 121 LLO V-80 T-ill' 8F8-OBAT 1 #5 1011 121 534 LBO 8'-O' 9'-4" 8F8-IB/2T 1 #5 2 #5 1 152 1 Soil 512 L90 T-O" 10'-4' 8108-I15/2T I #5 2 #5 1 1.43 1 530 401 L90B sl 10'-6" 81111 ONE I u5 2 #5 1 1633 1 1183 401 LI00 10'-0' ll'-4" 8F8-IB/2T 1 #5 2 #5 1 582 1 494 452 LIOOB 10'-O• 11'-4" aFIL-IB/2T ONE I 1 #5 1 2 #5 13LL 1 1028 452 L120 12'-O" 13'-4' 8P8-I15/2T 1 #5 2 #5 411 428 324 L1205 12'-0" IT-4" BFIL-IB/2T ONE 1 $5 2 85 1015 110 324 L140 14'-0" IS'-4" BFI6-I15/2T ONE 1 $5 2 85 1250 609 2S9 LI&O IL'-O' IT-4" 8118-I5/2T 1 #5 2 #5 300 192 1 194 LILOB IL'-D" IT-4' 811I4-I5/2T ONE 1 #5 2 #5 960 Soo 1 194 - ALL LINTELS SHALL BE MADE BY CAST-CRETE. - LINTELS SHALL BE FILLED SOLID WITH 3000 PSI CONCRETE - REFER TO CAST-CRETE CATALOG FOR ALL INFORMATION REGARDING LINTEL CONSTRUCTION, HANDLING INFORMATION, AND SAFE LOAD REQ, REQUIREMENTS - LINTELS OVER 14'-0" LONG ARE TO BE PRESTRESSED. Simpson HETA 20 or equal hur Icpp a nc or a each truss wit (I'�) PO x I �/2" nails — ( 24" o.c.) supporting Max 1810lbs. uplift Aluminum Drip _ Edge f Fascia IT, 2" x G" Sub-F Kagean full o vent vingl soffit installed using1/8 dia shank x 1.5" long gale. roong nail* with 3/8' die. head per product approval -see chart sheet #1 12' x 12" concrete column block filled with concrete and (2) #-1 bar* vert. tied, into lintels above thicken edge to S"xB" with concrete and one #5 bar continuous BEYOND Top of factor IG" below finished floor 12 4 Aluminum Drip Edge t Fascia Flash and Counter flash Nail ledger to gable end truss with (2) IOd ils at each web Aluminum Panel s,see per manufactwer — sae Timwal Stud Detail 1/8' x 3/32" Wing Nut w/ appropriate masher and spacing i per manufaetwar's Details OG3' .01T E n I � Stud Detail Stud w/ Die Cost Zinc NTa Nickel Plated wing Nut 1/4' Flush Mounted Shutter Detail nts 1/2' thick stucco on 3/e' hi -rib lath attached to horizontal and vertical wood framing with nails or staples to provide as Ise than 1-3/4' penetration into horizontal wood framing and 3/4" penetration into vertical wood framing members 5/e" thick light textured stucco on typlcal concrete block construction Varies - see plan T 45 bar Vert. w/ ID 30" overlap at each filled cell Rear Patio/Slab to he flush with bottom of sliding door recess. Wood Base Brace Gable and with 2" x 4" SYP #2 8ft back nailed to bottom Of top chords using (2) IOd nails at oath tTuna PRE-ENGINEERED WOOD TRUSS 9 24"o.c. TYPICAL ( shop drawings by manufacturer l \R-30 blown fiberglass in bottom chord of trusses -1/2' drywall with smooth Finish Two rows of beam block filled with concrete _and (U #5 bar cant. in each row. Substitute precast lintel filled with concrete and (1) 95 or cont. for bottom row over openings 1/2" drywall over I" x furringg strips at 14" o.c. with R4.1 Pi -foil -Insulation on typical 8" Block walls All drywall to be installed per FBC R102.3.1 and shall meet all pertaining ASTM codes. Mortar to be Type "M" only proportioned per FBC RGOI.I and Mortar joints shall comply with FBC R601.2J_ Provide Our-O-Rock at all wet areas (ex. showers, tubs etc...) Fill cell with concrete and (1) #5 bar vert_ (typical)_ -Max, sppacing shall not exceed 48" unleas otherwise noted see foundation plan notes for spacing at openings 4" concrete slab with fibermesh OR VxV #10/10 WWM on L mil Visqueen over / clean compacted termite treated fill ` •:':' IIII—IIII=IIII—IIII=IIII—IIII IIII IIII— I �:;.a-, 1i1� 3 Tplcal Section at Front Forth Scale : 1/2" = 1'-0" Strap truss to wall using Simpson MGT with Simpson HETA 20 5/8" die. threaded rod with min 12" embedment hurricane anchor at each truss into beam either wet set or in epoxy with „ (22) 10d nails into truss. Add blocking to ( 24 Q.C.) stpportin Max. truss leg per detail on this sheet 1810 1 S. uplift ETA 20 I� ETA 20 Simpson HETA 20 hurricane anchor at each truss ( 24" o.c.) supporting Max. 1810 lbs. uplift ry W PANEL "AI' Poles BR Load Wire Description tire# cre# Description Wire Load BR Poles 2 40 1.0 kw no A/C comp 1 2 AHU #Io 3.5 kw 30 2 3 4 2 30 4.5 kw #i0 40 gal. water HTR 5 1.Range #4 IZ.O kw 50 2 1 g 1 20 1.8 km #12 Pump 9 10 Dr ar #10 5.0 kw 30 2 II 12 1 20 1.5 km 212 13 14 Dishwasher #12 1.2 kw 20 1 1 20 1.5 kw 212 Microwave 15 IL Refrigerator #12 1.2 kw 20 1 1 20 1.5 kw 412 Kitchen S.A.C. n 18 Recepts 412 - 20 1 1 20 1.5 km #12 Kitchen S.A.C. 19 20 Recepts #12 - 20 1 1 20 1.2 kw $12 Clothes Washer 21 22 Racepta #12 - 20 1 I 20 0.81 kw #12 Garage Door Opener 23 2q Racepts #12 - 20 1 1 20 1.4 kw #12 25 26 Recepts #12 20 1 1 20 1.42 kw #12 21 28 Recepts #I2 20 1 I IS #14 General Lighting Z9 30 Recepts #12 20 I I IS #14 General Lighting 31 32 Recepts #12 20 1 I 15 #14 1 General Lighting 33 34 Exterior GFCI #12 20 1 I 15 #14 General Lighting $5 34 Bathroom GFI #12 20 1 I 20 #IZ Smoke Detectors31 38 General Lighting #14 15 I 1 20 #IZ Bathroom GFI 39 40 General Lighting 214 I5 I s are 41 42 1 stare PANEL "A" LOAD CALCULATION SHEET Load Description Qt . Watts Total(Watts) General Lighting (3, watts sq: Pt:) ,Small, Appliance, Grcultls) ........ ............................... !�anfle......................................................... Refr19erator.................................................. .Microwave............ ........................ I ....... Dish . Washer. ............. ... ......... .. .. . ....... . ..... . ......................... Clo;has,,lUasher 1. .... Clothes..Dryer............... ..................... Water Heater ................................................. Water Pump Garage, Door. opener........, .. . .... . . ........ 1135 3 5,205 2 _ 1,500 3,000 I 12,000 12 000 I 1200 1,200 I 1500 1.600 1 1,200 1200 I 1 200 1200 I 5,000 5,000 1 4,500 4 500 1 1,800 1800 1 810 SO Total Watts 31,415 First 10000 Watts e100% 1 10,000 10,000 Remainder 21,415 040% 1 O 10,946 Electric Heat or A/C 10,000 965% 1 10,000 10,000 Calculated Load Watts 30,96L Voltage 240 Calculated Wattage Divided bg Voltage = Total Amps 1 129.03 Panel Size Required = 150 Amps Electrical S mbol Legend $ Single Pole Switch ® lRecessed Can Light Double Pole Switch ® Egeball Recessed PB Push Button switch _0' Exhaust Fan Duplex Outlet ¢ Ceding Mounted Light Special Receptacle 0-Wall Mounted Light Waterproof, ground fault interrupter Light with Pull Chain (attic) ® Floor Duplex Outlet © Computer Connection Jack cn Carbon Monoxide Detector Flood Light Thermostat m Electrical Panel ® Central Vac F:31 Electrical Meter ® Smoke Detector Calling fan ® Television Jack S❑ Telephone Jack nc oec A/C Disconnect ® I x 4 Florescent Light ® 2 x 4 Florescent Light ® Speaker Hook -Up ❑i Intercom .10 Opt. PATIO/SLAB PORCH I I 163 CFM IOXIOXI Centers Registers on stalling Pan I I I BEAT OM DINING ROOM THIRD BEDROOM 84 CFM IOxLxd 18 Vent thru II = JUNCTION BOX TO SUPPORT A FAN A/C disc. O = THERMOSTAT LOCATION B/A = Balanced Air ISO #2/0 Aluminum feed Mc® 215 CFM Electric Notes: IrP " 12xLXl I. Use copper wire only, no aluminum. 2. Provide and wire all required amok& detectors. 3. Contractor to verify location of electrical CJ' ECOND service and provider. BEDROOM 4.ALL paddle fans shall be on a rheostat. • 5. ALL ath and kitchen receptacles to be GFI protected. 2PV 6. ALL exterior outlets to be WP/GFI protected.1. Recessed cans to be installed per NFPA requirements. 8. AFCI receptacles are reqquired in all rooms except 9. Kitchen, Bathrooms, and Garage. A/C Return Air Balance Must comply w/ FBC RM14022• wir. rr in sieh 10. A/C RefriPgVC lines that are run thru slabs must be sleeved PVC in ELECTRICAL RISER- 11. ALL A/C Equipment shall comply with energy calculation 12. All work shall be performed bg a licensed electrical NTS contractor, the completed system shall be fully operative, _Contractor shall use AL-CU Lending lugs. - Contractor shall torque lugs I.A.W. 13. Contractor shall pay for all fees, permits, testing, and manufacturers recommendations which be to inspections including blower testing where required. shall verified prior construction 14. All work shall be coordinated with other trades to avoid interference with the progress of construction. 19. The electrical s stem shall be tom sates and effective] y p y g 15. All required insurance shall be provided for protection grounded as required bg the latest edition of the N.E.C. against the public liability and property damage for the 20. All material shall be new and shall bear underwriters' duration of the work. labels where applicable. 14. Contractor shall guarantee all materials and workmanship free of defects for a period of not less than two years from 21. All equipment and panel sizes shall be verified before the date of acceptance or certificate of occupancy, or one ordering. The contractor shall provide circuit routings to year from closing sale of house. suit the Job conditions. Correction of defects shall be completed without additional charge and shall include replacements or repair of any 22. Furnish and install all fixtures as called for on the plans other phase of installation that may have been damaged. or as selected by others. li. It is not the intent of these plans to show every minor detail of construction. The contractor shall furnish and install 23. All raceways and pipes placed in or through any concrete all items for a complete electrical system and provide all slab shall be spaced a minimum of three diameters of the the requirements necessary for the equipment to be placed in largest conduit or pipe from any other service. proper working order. 18. All work shall be done in accordance with the N.E.C. and 24. All exposed wire below 9'-1" shall be installed in metal EMT shall comply with all local codes and ordinances, and shall conduit. meet all standard requirements of the local electric utility and teleehone comoanu. 25. Dryer Vents to be installed per FBC RMIS02 / ICJ 12x12x9 B/A 163 CFM IOXIOXI 12" 139 CFM IOXIOXI M�STER B ROOM 139 CFM IOXIOXI r� /1 i- ICJ 12xIB/A 8 CFM O / r I / - ��-- .Q e MTCHEN 411A 144 CFM 12xLxl 71 22" x s4•� 1 Attic Accea i with light _ - - _ _ J \�4"40 Steel Ballard See detail on this sheet 150 Amp Panel GARAGE f----------------- 1 I I I I I I I I I I I I I I I I I I I I I I I I MECHANICAL LAYOUT O=THERMOSTAT LOCATION SCALE: 1/4" = I i -Orr Vent thru -Soffit SEE MANUAL "J" and Energy Calculation for Unit info Exhaust Duct Thru Soffit Wire For a Front Post Light wP Opt. PATIO/SLAB i ®\ WP GFCI FVYY \ 777`I V � / I GRF_AT ROOM MASTER BEDROOM / •-� --- - - - - ISmoke / Carbm Mmmde Detester Combo I I I P II II II I DINING 1 ROOM I t I iI \ I �I THIRD BEDROOM / k1, LO'SET I�I G Cl / \GFfCI S I E \ zir' �n 3'-2"� 2. 1 Pro71'lm7w"IRRIM If'.I'�11111111111111154 O a PCB \\� � to ealrr �SBC�ND �J I BEDRIOOM I Center Post Light on This corner i �w v_ > m Post Light with � e /Photo cell I 1 2Y x 54" �J4,i2"h GFCI S Pd I I I Attie Aces 11 with fight / I _ J -4"lli Steel Ballard I See detail on this sheet 33Pull chain / I PC fight in attic / / OPTIONAL PANEL / 11' Amp LOCATION / anel 42"h GFCI / ==8 GARAGE// Garage Doer Opener f----------------- 1 I I I I I I I I I I I I I I I I I I I I I I I I \ it CV n Exhaust Duct -.9=hra Soffit (4" Exhaust Duct Thru Wall WP GFCI Install disc. to \\under disc. 0 not shown for clarity A/C 0 I ELECTRICAL PLAN SCALE: 1 /4" = 1'-a11 EBC 2309.1 Attic Ventino Calculations Total Attic Sppace = 2481 sq. ft. Venting Ratio 1/150 = 16.58 sq. ft. required Provide A Continuous Vented Soffit Braden Braden ,4�,4, FA UJc�nne Building Corp. MODEL: Date Drawn : Revisions : Sheet Comm # Architects - Planners GARAGE 3-28-18 411 S.E. Coconut Avenue 0 THE R O Y A L E RIGHT Drawn by: - I 12-101 Tel : (112) 281-8258 C.C.U. Spanish Lakes Fax : (112) 281-8283 E-mail: bradenaiascomcast.net Checked by: Stuart FL 34994 #AAC000032 St. Lucie County Florida OF 5 01 A=LIFE SAFETY WARNING A ARRANGE WITH CRANE OPERATOR IN ADVANCE FOR A SPREADER BAR OF 18' - 24' IN LENGTH This symbol identifieWlLife Safety Warnings that should beread Do not stand on trusses until they are braced per BCSI & properly nailed to straps & hangers given special attention by all persons installing trusses. I 96. 5PAGING NOTE ALL TRUSSES ARE BE SET AT 2'-0 ON G NTER EXGEPT AS � TED nI DON'T LIFT TRUSSES WITH SPANS LONGER THAN 30' BY THE PEAK. MULTIPLE PLY TRUSSES MUST BE ASTENED TOGETHER PER ENGINEERI BEFORE SETTING. REFER TO ENGINEERING DRAWING TO DETERMII' ® IF MULTIPLE PLY. 30' Span or less 0 degrees or less *--- 1 /2 Tag Line span approx REFER TO BCS� Truss must be set this way if cf ne used. Truss Is on example, your truss may match. Insist crone operator sets truss this way. 30' to 60' Span A Spreader Bar To �Approx 2/3 to Line 1/2 of Span REFER TO SCSI lss must be set this way if crane used. This is an example, truss may not match. Insist crane operator sets truss this way. All load lbearing walls, headers, beams & lintels must be in place at indicated height before trusses A are installed. A AI F= HAIV LIE-tF=:;-- NOTE UNLESS NOTED ELSEWHERE ON THIS LAYOUT, THESE TRUSSES ARE NOT DESIGNED FOR AIR HANDLERS IN THE ROOF OR FOR ANY OTHER A/C REQUIREMENTS. THIS MAYBE IN CONFLICT WITH BUILDING CODE AND A/C DESIGN REQUIREMENTS. CONSULT WITH BUILDING DEPARTMENT AND A/C CONTRACTOR. For Truss to Truss Connections see hanger/connector schedule in engineering package. SEAT P I I I I I I I� Carrying Girder Nails must be as shown. Guide tabs o Dome angle nails. Truss a0ess,"es ci Are NatBE 0, nes.6tN31essu, ZK O a6J ox -48ii IN 2e O C. THRa CORNER 1. II� I'1•.IiR 1. ONLY.WCKS � 1 2C 'NER DETAIL 3S NOT SHOWN FOR CIARMY TES BY CHAMBERS INDICATES LOAD BEARING REQUIRED BY TRUSSES SUPPLIED BY BUILDER AT A HEIGHT OF V-1" ABOVE FINISHED FLOOR 12 4.00 F-- eel =3 15116" LUMB CUT END 2 x 4 Top Chord (SEARING HEIGHT 8'-l" TYPICAL END DETAIL C 14' 21' 2'-116" � 1D CD m rA o7 m 1D m ® t\e 1D r0 R N N J2 aN J2 Ja ao Ja 0 J6 J6 GR( A6 I " A4 I A3 I I A2 I I Al Al I I Al "t0 I N Al 13'-72" 121 I IN . Al I I I Al I / I N Al t0 I Al I Al Nv A `s: A LU to Q - tN U- A ILLT-UJ U _) Q ❑ F- Q A m j tli w a. is -j 2. A LU co CI A K � 2! cl A EN Cell A 7 SETBACK BOSTON HIP TRUSS BH7 - GRB N I J3 B J7 B B GRA I I 0 I I----o JC - O - T - - - - - - - - -- - - - - - - - - - - - - -- JC 1'-84 1' 84. 1 T-10" 5'-4" 2'_2" 9'-6" 35' GARAv E LEFT GARAGE RIGHT FAB CA nolq AGREEMENT crurNOT eesrARreo u►m� Tx,a ?t"name "oarraaroneoarteeruwtso WePa?YM1tma the wa 6s bytes . 7:. Trusses wall be made ti Zrj; '"'"'Vft this Pleoerrrem . wldd'b the ids atdllpryy to ° fall Within Whtys 2 N dim ithie ti thb Iayddt tyre b,«, febuea6on afuy btreees. �Yeat .3, lMs1a wrtdenft rrodoe b prpylda by wed � y1 k1 �°� - . a d wrpbniwtica Y eRese ben Tivu - . t TMrePeka requtred, �r4 6e?am at buv�lowad.rn tlro Chenrbara oD�n.' days to w,drJr A ft _n.rw«y.TP18 Wrp1 °0 oarcn.adxr.for r .urra�aaaipeelobo; bsrauw jpb�aM kpnfoprrasdd�tlpny dsp +Y �SPetnes we be it 6tger6 responal6b to mbae Trwafor or buyer is not Thus to Prepend to or �derwer 7 iyreaner a raesode6lNWW am made ki CMwloe wn a"mr ad, offt very :Ted w, a p " - bnWilsey of mvola biriee�s The s Ww'd' 0' date aerwy a yer rI for a9xmr■ In etleRt 01 e 1 0 0ey Mainber..r " . arlydtls�besewro paid jay° made.,-1!t%germ's 9,.swisturs In oayldera°on of f= oITTAM 001pf 0' wr°°^�rc re ai tame lrereln T lrosrarrtres PaYmeM when .end u the anaaelyrod debam roe a+r arty rernehMp matalat end uy Yidee owed to ' Imo., tees. a debadt to pey,,,eM fora" irteM,ty°° j '10. m the a ' "°" corroanu, rsarynt, the Amu - - . � � corny. F1ork�e. dnt Pare OW" ew the qde taus for SM such souwill IS -4 _ y � Uft Mebt Phil Conned Wood Trusses edCiuW°Itroe On 6efo s the ayro must be fastened engineering Y set: failure to do so can 9 h to roof collaTemporary and and Is ttt 6recla8 are usqulrsd and can save Itfe and property and b tM rosPonslbllMy of the truss erector, SWdy the counts of the Information pac&et Included on deffirliny ole befom aetdnp trusilee : 71,reeesmluttwaetsndtsacedtlerrlesrpllkttrevardtlift6 dtinepsx Trusses must be set Plumb and square DO ".O?t bunks or abck OMar pdotiwntretsd loads an � :r O9 matedal or any .. I slew 11V a aer /MUSSES US/ATG �//— S— USE LAYOUT DELNERI:p WITH TRUSSES TO SET TRUSS CHAMBERS TRUSS INC A� 3105 Oleander Avenue Fort'Plerde; Florida 349824423 800-551-5932 . Fort Platte 7T2"46&2012 .Vero9aach ' 772-68-2012 F �'�6-8711 .avL a Stwrt '772.288-4,702 ' sh race's ..shop,, o o dre or g I rch/to Tf, 4,bWlyt s°pn •� a gt,p Crsr a� h s h.• r rPr ba e otf 'hc.r&i^'9 haq h® oo/a H�Tonr4r/ve. fr 'pl>rpp :.ylr4Crje/tl �® M2e/A' rra�roa e ^pYerg n Cr/ter 4renleepOfr91 1 / n 'rr 9enrr a, Orr is aAp e A tilpir rtS rduit in9,.b/na Ofs /'�rE'Cris. P,0% C aid 4 tl josh As, are. ea q f•,4C�Jllf ff ns• laao %ng ery s aq 920/93.2 MITEX 4.2 - BregM g\ d DESIGN CRITERIA era"dew q.lq• P,A. —.., County SAINT LUCIE Building Department ST LUCIE COUNTY Wind Design Criteria ASCE 7-2010 y�l Wind Design Method MWFRS/C-C hybrid Wind ASCE 7-10 " Roofing Material Metal Roof a a Loading in PSF Roof R.D.L. r ° Top Chord Live 20 E I ��°'r Top Chord Dead 7 4.2 �I Bottom Chord Live 10 Non -Concurrent R 30 "I (Bottom Chord Dead 10 3 TOTAL Load 37 7.2 1- _R Duration Factor 1.25 �+ Wind Speed 165rnph 20 2 Top Chord C.B. Sheeting by builder. U Bottom Chord C.B. Sheeting by builder. Highest Mean Height 12'-0" Building Type ENCLOSED Building Category II:Non Restrictive Exposure Category C Barrier Island No Conforms to FBC 2017 W H Cn Q 27 TRUSS DRAWINGS ARE ATTACHED TO LAYOUT ...�.-,%wuore III IM 11l 11J LYOU li.cuZ;ko r➢rrUOu$ 13raCin 1 Verify DESIGN CRITERIA shown above with the building department and your engineer. Design Criteria is the responsibility of the Chambers Truss Inc. Drawing Name: M11324 Scale: 1/4 = 1' 83 total trusses, 27 different trusses. MI 4: SAE ACAD: SAE Reviewed By: Date:07/19/12 Revised:03/21/18 FOR WYNNE BUILDING CORP. DESCRIPTION: 701 CARLTON, ELEV. D PAGE 1 of 1 CUSTOMER INITIALS EACH PAGE M 11324 -757)9 l y�'9% eaoe W4